Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIHYPVYFFFELIQASCNEYIASGSNKEDIMLLNRKHSLVSCFDLELLETHPVKIKNSKVKQKNFITVSLEFSFKKIPPIF 2PYQ Chain:B ((37-58)) -----------------------------GPAIYNRDASTVAGSDTAELET-------------------------------

General information: TITO was launched using: RESULT: Template: 2PYQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 18 -1722 -95.67 -78.27 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -95.67 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.380

(partial model without unconserved sides chains): PDB file : Tito_2PYQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2PYQ-query.scw PDB file : Tito_Scwrl_2PYQ.pdb: