Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVAAPAGGAAAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAPQVLKEGVSKEEGEELKKKLEEAGATVTLK 1RQS Chain:A ((47-120)) -------------------------------------------------AAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK

General information: TITO was launched using: RESULT: Template: 1RQS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 274 -26159 -95.47 -353.49 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -95.47 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.777

(partial model without unconserved sides chains): PDB file : Tito_1RQS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RQS-query.scw PDB file : Tito_Scwrl_1RQS.pdb: