Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAENVGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAEETWTGRGKQPRWLVAEI-EKGAKLEDFLI 2L93 Chain:A ((99-135)) ------------------------------------------------------------------------YVDENGETKTWTGQGRTPAVIKKAMEEQGKQLEDFLI

General information: TITO was launched using: RESULT: Template: 2L93.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 74 -3281 -44.34 -91.14 target 2D structure prediction score : 0.89 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -44.34 2D Compatibility (Sec. Struct. Predict.) : 0.89 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.791

(partial model without unconserved sides chains): PDB file : Tito_2L93.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L93-query.scw PDB file : Tito_Scwrl_2L93.pdb: