Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFWQKLFLADQQHNEHKNQTACVENDCSCKTNEQLLSALAQAT----DEDVIKGIKKVLISRGYSRKELNELTQKTSIH 3FYR Chain:A ((5-38)) -------------------------------SDELLIESYFKATEMNLNRDFIELIENEIKRRSL---------------

General information: TITO was launched using: RESULT: Template: 3FYR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 43 -2690 -62.55 -89.65 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain A : 0.71 3D Compatibility (PKB) : -62.55 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 1.014

(partial model without unconserved sides chains): PDB file : Tito_3FYR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3FYR-query.scw PDB file : Tito_Scwrl_3FYR.pdb: