Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MARNADYIDIAGFTIAPQTLLPYGHLYNASLAGNQLNSAHGFAGPILAAPIWLINKPERFFAIAPYLYVPIGTYHSDEALNIDENRWKFDLQLGVFNNVAMIFLPKSRPMLFDMVHMMILLE 3CG1 Chain:A ((57-78)) LGRKADVIGVADYTLIPQLLIP----------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3CG1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 15 -6688 -445.87 -304.00 target 2D structure prediction score : 1.00 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -445.87 2D Compatibility (Sec. Struct. Predict.) : 1.00 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.425

(partial model without unconserved sides chains): PDB file : Tito_3CG1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CG1-query.scw PDB file : Tito_Scwrl_3CG1.pdb: