Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MMSSMSLTDYHATCPKAQKVKKGRNKFNASKIKLDGMTFDSTKEYKRYIELKALQQRGEIKELQHHTK-FELAPSVKIEEEKRKKPALRYFADFTYFTAAGDYVVEDVKSIATRKLPSYRNKKHLMKTVHNI-DVREV 1M0D Chain:D ((6-81)) ----------------------------------------SGLEDKVSKQL---ESKG--IKFEYEEWKVPYVIP---------ASNHTYTPDFLLPN--G--IFVETKGLW---ESDDRKKHLLIREQHPELDIRI-

General information: TITO was launched using: RESULT: Template: 1M0D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 88 4017 45.64 54.28 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain D : 0.63 3D Compatibility (PKB) : 45.64 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.311

(partial model without unconserved sides chains): PDB file : Tito_1M0D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1M0D-query.scw PDB file : Tito_Scwrl_1M0D.pdb: