Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALTEKKKAFALAKRNGKDNKEAAILAGCPEKTASAAGARLAKDPDVIAYLERLEEATPEQAVKHEVKPLTTFTSIQTANKLDDPLEFLKSVYTDQVEDMALRV-----RAAQAALPYVHGK-VAEKGKKETKEDAAKAATKTGKFGTLNNQLPS 4ZN6 Chain:A ((203-291)) --------------------------------------------------LEQLVHVTPQQACK-----MGQKISVDSATLMNKGLELIEACHLFSISEHFVTVVVHPQSIIHSMVQYVDGSTLAQMGNPDMCTPIAHA----------------

General information: TITO was launched using: RESULT: Template: 4ZN6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 136 1800 13.24 23.08 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 13.24 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.342

(partial model without unconserved sides chains): PDB file : Tito_4ZN6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ZN6-query.scw PDB file : Tito_Scwrl_4ZN6.pdb: