Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRILKSILFEFEELMSQQSVEKKSVPWLLMGLGLLIPFLIIGILFLAAKSDAQNKKQYEQQRLEMEKRIAEKEAANSDKK 2WN7 Chain:A ((70-96)) --------------------------------------------------------ERKEAERIEQKLERSEKEALESYKK

General information: TITO was launched using: RESULT: Template: 2WN7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 11 1794 163.09 71.76 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : 163.09 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.823

(partial model without unconserved sides chains): PDB file : Tito_2WN7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WN7-query.scw PDB file : Tito_Scwrl_2WN7.pdb: