Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTKRTPI-SFEFFPPKTDASAEKLRIVHQELQHLNPEFFSITYGAGGSTRERTLAAIEDFNGKGTPVAPHLSCIGDDKTRIAELLDLYKAQGIDRIVALRGDLPSGQVGLGELP----YAQDLVRFIREHSGDHFHIEVAAYPEMHPQAESLDSDIQRFIEKVQAGANAGITQFFFNPDSYFYFIERLEKAGINIPVAPGIMPITNASNLIRFADGTGAEIPRWIRKQLQAYGDDSESIKAFGHEVVVKLCERLIAGGAPSLHFYSMNQVEPTRQLVVDLGLN
1V93 Chain:A ((9-290))-ARRGPLFSFEFFPPKDPEGEEALFRTLEELKAFRPAFVSITYGAMGSTRERSVAWAQRIQSLGLNPLAHLTVAGQSRKEVAEVLHRFVESGVENLLALRGDPPRGERVFRPHPEGFRYAAELVALIRERYGDRVSVGGAAYPEGHPESESLEADLRHFKAKVEAGLDFAITQLFFNNAHYFGFLERARRAGIGIPILPGIMPVTSYRQLRRFTEVCGASIPGPLLAKLERHQDDPKAVLEIGVEHAVRQVAELLEAGVEGVHFYTLNKSPATRMVLERLGLR


General information:
TITO was launched using:
RESULT:

Template: 1V93.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1411 22464 15.92 81.10
target 2D structure prediction score : 0.74
Monomeric hydrophicity matching model chain A : 0.81

3D Compatibility (PKB) : 15.92
2D Compatibility (Sec. Struct. Predict.) : 0.74
1D Compatibility (Hydrophobicity) : 0.81
QMean score : 0.659

(partial model without unconserved sides chains):
PDB file : Tito_1V93.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1V93-query.scw
PDB file : Tito_Scwrl_1V93.pdb: