Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFRRYPYSDSSNSEEKRRKNMKYFQLVLTLITAMVIEVLEQKLA 2P06 Chain:A ((22-45)) --------------------MDYFRLAEKFLREMHAKYMKRVSR

General information: TITO was launched using: RESULT: Template: 2P06.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 7 -1726 -246.57 -71.92 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -246.57 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.347

(partial model without unconserved sides chains): PDB file : Tito_2P06.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2P06-query.scw PDB file : Tito_Scwrl_2P06.pdb: