Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKSYRLEGLDCANCAMKIEKGVQKINGVKEATVNFTSGKLTD 2OFG Chain:X ((16-49)) -------GMDCTSCKLKIEGSLERLKGVAEASVTVATGRLT-

General information: TITO was launched using: RESULT: Template: 2OFG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain X - contact count / total energy / energy per contact / energy per residue : 58 -9025 -155.60 -265.44 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain X : 0.86 3D Compatibility (PKB) : -155.60 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.555

(partial model without unconserved sides chains): PDB file : Tito_2OFG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OFG-query.scw PDB file : Tito_Scwrl_2OFG.pdb: