Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------------------------------------CDFIIK-QNGTQITSGNIWAGATANFLVSGKWAVVSATSECKLSLSG---LPNNESYTILPTQDE-----ETEGEDIEQADTPEAS---------------------------------------------------------------------------------------------------------------- 1SFN Chain:A ((1001-1245)) MKHLGQTRSALHGSHAVITPETFVRTALAEWPGSAIVLHIAPVVGLGARFVQFTAEMPAGAQATESVY---QRFAFVLSGEVDVAVGGETRTLREYDYVYLPAGEKHMLTAKTDARVSVFEKPYQTVEGVQAPGVYWGNERENPGYPFEGDDHLIARKLLPDEPAFDFMVSTMSFAPGASLPYAEVHYMEHGLLMLEGEGLYKLEENYYPVTAGDIIWMGAHCPQWYGALGRNWSKYLLYKDMNRHPL

General information: TITO was launched using: RESULT: Template: 1SFN.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 187 11621 62.14 157.03 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : 62.14 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.491

(partial model without unconserved sides chains): PDB file : Tito_1SFN.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1SFN-query.scw PDB file : Tito_Scwrl_1SFN.pdb: