Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KSYKAQKICHFTILKMYKNTWTFVRKDS---APADQTT-----TIEGIKVFFSKDCIPQHDYRGLYIEYNGFHHDVSQS---------- 1ET9 Chain:A ((1-95)) NSYN--TTNRHNLESLYKHDSNLIEADSIKNSPDIVTSHMLKYSVKNLSVFFEKDWISQ-EFKDKEVDIYALSAQERYEAFGGITLTNS

General information: TITO was launched using: RESULT: Template: 1ET9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 171 6807 39.81 100.10 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : 39.81 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.67 QMean score : -0.011

(partial model without unconserved sides chains): PDB file : Tito_1ET9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ET9-query.scw PDB file : Tito_Scwrl_1ET9.pdb: