Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KCVIKRVFSDGSSVKIPAQPAQSTTISKQAVWVYGNCQPFPVVLNDGSKLSGEIETPAVTPVESVDEDDCFELDISGQR- 2JN4 Chain:A ((1-66)) MKVMIRKTATGHSAYVAKKDLEELIVEMENPALWGG----KVTLANGWQLE----------LPAMAADTPLPITVEARKL

General information: TITO was launched using: RESULT: Template: 2JN4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 282 -13124 -46.54 -201.90 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -46.54 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.244

(partial model without unconserved sides chains): PDB file : Tito_2JN4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2JN4-query.scw PDB file : Tito_Scwrl_2JN4.pdb: