Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --------------------YCEYYIKTLEGWELVGWVKIGGQDELTWKGDSIGVKAED-----TNCKVVLVNGQRAPVW--LTAVP 1D3C Chain:A ((497-583)) ATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLS

General information: TITO was launched using: RESULT: Template: 1D3C.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 199 -4480 -22.51 -74.66 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -22.51 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.279

(partial model without unconserved sides chains): PDB file : Tito_1D3C.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1D3C-query.scw PDB file : Tito_Scwrl_1D3C.pdb: