Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHKKVEKRTSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYYLTDNLTFSSIYALIQHY 3TKZ Chain:A ((9-84)) WFHPNITG-VEAENLLL-----TRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGD----YYDLYGGEKFATLAELVQYY

General information: TITO was launched using: RESULT: Template: 3TKZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 286 -38891 -135.98 -511.72 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -135.98 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.696

(partial model without unconserved sides chains): PDB file : Tito_3TKZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3TKZ-query.scw PDB file : Tito_Scwrl_3TKZ.pdb: