Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WNVGSSNRNKAENLLRGKRDGTFLVRESSKQ--GCYACSVVVDGEVKHCVMNKTATGYGFAEPYNLYSSLKELVLHY 2IUI Chain:A ((13-88)) WYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLT-FSSVVELINHY

General information: TITO was launched using: RESULT: Template: 2IUI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 255 -10945 -42.92 -147.90 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -42.92 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.832

(partial model without unconserved sides chains): PDB file : Tito_2IUI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IUI-query.scw PDB file : Tito_Scwrl_2IUI.pdb: