Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGFITRRVRPPLSVTHREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRHFLLAQLRDGRHVVLGEDSAHARLQDLLLHY 2Y3A Chain:B ((196-270)) WYVGKINR----------TQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATG-FGFAEPYNLYGSLKELVLHY

General information: TITO was launched using: RESULT: Template: 2Y3A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 275 -47787 -173.77 -637.16 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain B : 0.72 3D Compatibility (PKB) : -173.77 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.500

(partial model without unconserved sides chains): PDB file : Tito_2Y3A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Y3A-query.scw PDB file : Tito_Scwrl_2Y3A.pdb: