Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFVEDINRVQAEDLLYGKPDGAFLIRES-SKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHY 1R1S Chain:G ((11-85)) WFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEK-FPSLNKLVDYY

General information: TITO was launched using: RESULT: Template: 1R1S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 257 -29240 -113.77 -395.14 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain G : 0.75 3D Compatibility (PKB) : -113.77 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.716

(partial model without unconserved sides chains): PDB file : Tito_1R1S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1R1S-query.scw PDB file : Tito_Scwrl_1R1S.pdb: