Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKIILASAMSGVVLLLGACATTPKNTLAIQKENNQFEVTGI-GKTNLIAKNNAVTAAQKTCSKSTTPVIVDEKTSYHGVLKDVVSEKTGQMVEAAAGVIGTLTGKNASLAKDDDYQTTLTFYCKIN 2YIZ Chain:B ((9-43)) -------------------------------------EIVGTSPDGVDAAIQGGLARAAQTMRAL-DWFEVQS------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2YIZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 58 2908 50.13 85.51 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : 50.13 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.736

(partial model without unconserved sides chains): PDB file : Tito_2YIZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2YIZ-query.scw PDB file : Tito_Scwrl_2YIZ.pdb: