Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------------------------------------------------MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRK-----KAAAVKRYQKKLARESVRTTRLY---------------------------------------------------------------------------------------------------------------------------------------------------------------
5DWB Chain:A ((1-278))MRLDLDFGRGLVAHVMLDNVSEEQYQQISDYFVPLVNKPKLKSRDAIGQAFVMATEVCPDANPSDLWHHVLYRIYIREKIGTD---------PSQSWVRTSGEAFEVALVERYNPVLARHGIRLTALFKGQKGLALTRMGVADRVGSRKVDVMIEKQGGGRSPDAEGFGVVGGIHAKVSLAERVSDDIPASRIMMGEGLLSVLSTLDVKSFPPPHGDLVNRGELGTPDRPSDKRNYIEGHGDFSACFSYNLRTSPSNATTPSGRHIYVSGFSGQDDEFTDYLVAQLA


General information:
TITO was launched using:
RESULT:

Template: 5DWB.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 139 1366 9.83 22.03
target 2D structure prediction score : 0.69
Monomeric hydrophicity matching model chain A : 0.56

3D Compatibility (PKB) : 9.83
2D Compatibility (Sec. Struct. Predict.) : 0.69
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.387

(partial model without unconserved sides chains):
PDB file : Tito_5DWB.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5DWB-query.scw
PDB file : Tito_Scwrl_5DWB.pdb: