Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence --MNEIEMFCELLSLLGLKVVPKDYQSIDKERVAALLVMSKSWMNRIETVDDLFHDEISCQKEKLGY 5TJ5 Chain:L ((1-57)) YTVVGVFIVVSAMSVLFWIMAPKNNQAVWRSTVILTLAMMFL----------MWAITFLCQLHPLVA

General information: TITO was launched using: RESULT: Template: 5TJ5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 78 -11600 -148.71 -210.90 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain L : 0.64 3D Compatibility (PKB) : -148.71 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.421

(partial model without unconserved sides chains): PDB file : Tito_5TJ5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5TJ5-query.scw PDB file : Tito_Scwrl_5TJ5.pdb: