Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------MSFWQKLFLADQQHNEHKNQTACVEND------------CSCKTNEQLLSALAQATD-------EDVIKGIKKVLISRGYSRKELNELTQKTSIH------ 4Y7S Chain:A ((1-111)) NPYTIYPPVPKTASINGFADRIYDQIPKCAQECVKQSTSSTPCPYWDTGCLCVIPNFTGAVGNCVASKCRGADVTNFRKLAVGACAAAGVWDPYWIIPASVSSALDAAATA

General information: TITO was launched using: RESULT: Template: 4Y7S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 273 10457 38.30 137.59 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : 38.30 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.387

(partial model without unconserved sides chains): PDB file : Tito_4Y7S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4Y7S-query.scw PDB file : Tito_Scwrl_4Y7S.pdb: