Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLELIMRIEMKTSDVLARFNAPKIAKLLKISRQAVYQWGEFVPEAAAFKLLEQEPTLPVKRVS 1Y32 Chain:A ((1-24)) ----------------------------------------MAPRGFSCLLLLTSEIDLPVKRRA

General information: TITO was launched using: RESULT: Template: 1Y32.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 9 -765 -85.00 -31.88 target 2D structure prediction score : 0.96 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -85.00 2D Compatibility (Sec. Struct. Predict.) : 0.96 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.773

(partial model without unconserved sides chains): PDB file : Tito_1Y32.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y32-query.scw PDB file : Tito_Scwrl_1Y32.pdb: