Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------------------------MRTPRKRLWRKAFSFKSQ----GNRRYDKSFVTTPV---FLLAFISM--- 5MQF Chain:R ((23-229)) LSQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAAREKNRRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK

General information: TITO was launched using: RESULT: Template: 5MQF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 19 -932 -49.03 -23.29 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain R : 0.68 3D Compatibility (PKB) : -49.03 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.398

(partial model without unconserved sides chains): PDB file : Tito_5MQF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5MQF-query.scw PDB file : Tito_Scwrl_5MQF.pdb: