Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKNKFENRSDTRCGSFLYILYEVFFIPYEKIS-LKIKKDENKRFSIKRRPFIFCLYLCEKRKRAQHIKLLLIVCLL 3O27 Chain:A ((4-68)) GIRKLVVLNPRAYHTTFYLL-----IPKDIAEALDIKPDDTFILNMEQKDG--DIVLSYKRVKELKI---------

General information: TITO was launched using: RESULT: Template: 3O27.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 104 1238 11.90 20.97 target 2D structure prediction score : 0.19 Monomeric hydrophicity matching model chain A : 0.56 3D Compatibility (PKB) : 11.90 2D Compatibility (Sec. Struct. Predict.) : 0.19 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.289

(partial model without unconserved sides chains): PDB file : Tito_3O27.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3O27-query.scw PDB file : Tito_Scwrl_3O27.pdb: