Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRNYLVISIIALSVLLFFEITSVASLITEVKGQTHSSEHSSQSFKQSEQSTIKSQSTETANVKEAIQESAEKVQSQSSQSTQDSTEAIQDPTVKSVAISFDDGPGATTTPQLLRILKEKTCMSLFSS 4L1G Chain:D ((69-104)) ------------------------------------------------------------------------------------------PYNKAEVALTFDDGPDLEFTPKILDKLKQHNVKATFFL

General information: TITO was launched using: RESULT: Template: 4L1G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 48 -10728 -223.50 -298.00 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain D : 0.60 3D Compatibility (PKB) : -223.50 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.602

(partial model without unconserved sides chains): PDB file : Tito_4L1G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4L1G-query.scw PDB file : Tito_Scwrl_4L1G.pdb: