Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----MENPTFEESLQ-------ELEKIVMQLEQGDVP-----LESALDSFKR------GMELSKHCQDTL---AKAEETLTKMMTESNEEVDFDGNEES----- 2OCC Chain:E ((5-109)) HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

General information: TITO was launched using: RESULT: Template: 2OCC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 215 19502 90.70 263.53 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain E : 0.69 3D Compatibility (PKB) : 90.70 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.455

(partial model without unconserved sides chains): PDB file : Tito_2OCC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2OCC-query.scw PDB file : Tito_Scwrl_2OCC.pdb: