Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY 3EAZ Chain:A ((82-156)) WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSSDGKVEHYRIMYHASKLSIDEEVYFENLMQLVEHY

General information: TITO was launched using: RESULT: Template: 3EAZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 272 -54075 -198.81 -721.00 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -198.81 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.671

(partial model without unconserved sides chains): PDB file : Tito_3EAZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EAZ-query.scw PDB file : Tito_Scwrl_3EAZ.pdb: