Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SSSDTDSDSSPDRGLSRMCCVYKIHPGGNIWSTKKGEQAWFRRRFSKYEVMAYDRCNLEWGFSGKPRGLTFEFLWDKEAAADGTC 3J2P Chain:B ((1-72)) -----SVALVPHVGMGLETATETWMSSEGAWKHAQRIETWILRH-PGFTIMAAILAYTI-GTTHFQRALIFILLTAVAP------

General information: TITO was launched using: RESULT: Template: 3J2P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 106 -9541 -90.01 -132.51 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -90.01 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.030

(partial model without unconserved sides chains): PDB file : Tito_3J2P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3J2P-query.scw PDB file : Tito_Scwrl_3J2P.pdb: