Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEKMKCPNCGKKFAYEEVNNVVEHNDKEMPVVCPYCRTEAARIVTHGYFITEKIEDFLK 4QIW Chain:W ((8-36)) -----CAKCGKEVELDL---A----T-AREVRCPYCGSKILY-----------------

General information: TITO was launched using: RESULT: Template: 4QIW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 82 -9183 -111.99 -316.66 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain W : 0.64 3D Compatibility (PKB) : -111.99 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.524

(partial model without unconserved sides chains): PDB file : Tito_4QIW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4QIW-query.scw PDB file : Tito_Scwrl_4QIW.pdb: