Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----------------------------------------------------------------------------------------------------------------------------------------------------------------FDCYIERLQKEHMLSGMKAEPNKEAWID--GFEIWVYSNCRIHPTILPDGSIANGRFWSELDWFHTCEESESKSKSE--------------- 4N7R Chain:C ((55-306)) STHKPFPAEVSRSIMELSSVGTLSTLTHDGWPLGVGVRFAVDKDGTPVLCLNRSVSPDKRSALHVQLEQCGLRTPQCTIQGSIGRPGDDTVLKRLSATWREKFGEEVKEDSLYVVAVDRVLQMEDFMEDGIWVASSDYKNASPDPLRDIAEDIVNQINANNMEDIFRFCNVYVDLDFVVSETKMIWMDRLGFDLRVWSPRGVYDVRIPFPMEVTDEKGAKSSFNGMSQLAWEVEKSYCPADFNKVKLLKQVV

General information: TITO was launched using: RESULT: Template: 4N7R.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 202 726 3.59 9.68 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain C : 0.53 3D Compatibility (PKB) : 3.59 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.163

(partial model without unconserved sides chains): PDB file : Tito_4N7R.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4N7R-query.scw PDB file : Tito_Scwrl_4N7R.pdb: