Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----GC-QAELLNINQAVVGTGCVQMNYYANIYDSTRR----------------AGYTVNANSNCGLSFGNIQVI--PDGYSLRQAGYC----------------------------------------------------------------------------------
1IGR Chain:A ((300-478))KVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCEKEQKLISEEDLN


General information:
TITO was launched using:
RESULT:

Template: 1IGR.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 -1324 -5.11 -20.06
target 2D structure prediction score : 0.59
Monomeric hydrophicity matching model chain A : 0.58

3D Compatibility (PKB) : -5.11
2D Compatibility (Sec. Struct. Predict.) : 0.59
1D Compatibility (Hydrophobicity) : 0.58
QMean score : 0.140

(partial model without unconserved sides chains):
PDB file : Tito_1IGR.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1IGR-query.scw
PDB file : Tito_Scwrl_1IGR.pdb: