Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------NCIANILNINQAIVGS--GCIPAGGTAFVAANGAN-------WLISASRSCGLGLS--------------- 1HF2 Chain:A ((1-99)) MVDFKMTKEGLVLLIKDYQNLEEVLNAISARITQMGGFFAKGDRISLMIENHNKHSQDIPRIVSHLRNLGLEVSQILVGKVQSRTTVES

General information: TITO was launched using: RESULT: Template: 1HF2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 108 -5496 -50.89 -116.94 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -50.89 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.016

(partial model without unconserved sides chains): PDB file : Tito_1HF2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HF2-query.scw PDB file : Tito_Scwrl_1HF2.pdb: