Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMKIDILTLFPEMFSPL-EHSIVGKAREKGLLDIQYHNFRE-NAEKARHVDDEPYGGGQGMLLRVQPIFDSFDAIEKKNPR---VILLDPAGKQFDQAYAEDLAQEEELIFICGHYEGYDER-IKTLVTDEISLGDYVLTGGELAAMTMIDATVRLIPEVIGKESSHQDDSFSSGLLEYPQYTRPYDYRGMVVPDVLMSGHHEKIRQWRLYESLKKTYERRPDLLEHYQLTVEEEKMLAEIKENKE
4YQL Chain:A ((9-249))MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLG--------SFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQ----


General information:
TITO was launched using:
RESULT:

Template: 4YQL.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 955 35119 36.77 154.71
target 2D structure prediction score : 0.61
Monomeric hydrophicity matching model chain A : 0.87

3D Compatibility (PKB) : 36.77
2D Compatibility (Sec. Struct. Predict.) : 0.61
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.499

(partial model without unconserved sides chains):
PDB file : Tito_4YQL.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4YQL-query.scw
PDB file : Tito_Scwrl_4YQL.pdb: