Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMTANIMTTLKNQITDALKTSMRAKDMATVTVLRSLQAAIKQIEVDER-IELDDAQVLAVIEKQIKQRKESIKAFEGAGRDDLASKEQAEAEVLSQFLPEAMTEEELDSLIEQTIAAQEATSMKDMGKVMNSLRPIIAGRADPAQVSAKIKAKLA
1NG6 Chain:A ((1-148))------MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKLKKDSLTEDEELTVLSRELKQRKDSLQEFSNANRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINKLVSSQLS


General information:
TITO was launched using:
RESULT:

Template: 1NG6.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 471 12430 26.39 84.55
target 2D structure prediction score : 0.73
Monomeric hydrophicity matching model chain A : 0.77

3D Compatibility (PKB) : 26.39
2D Compatibility (Sec. Struct. Predict.) : 0.73
1D Compatibility (Hydrophobicity) : 0.77
QMean score : 0.724

(partial model without unconserved sides chains):
PDB file : Tito_1NG6.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1NG6-query.scw
PDB file : Tito_Scwrl_1NG6.pdb: