Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHMESIRYFDGEKHIEYSNTQEDVDFISFEEDKITKVNFKDGTCLKIVSPYIEYKSKWEQDDSDERDRFGW 1OGL Chain:A ((208-218)) -------------------------------------GYKEGVYVKVR-----------------------

General information: TITO was launched using: RESULT: Template: 1OGL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 2 -462 -231.00 -42.00 target 2D structure prediction score : 0.45 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -231.00 2D Compatibility (Sec. Struct. Predict.) : 0.45 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.744

(partial model without unconserved sides chains): PDB file : Tito_1OGL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OGL-query.scw PDB file : Tito_Scwrl_1OGL.pdb: