Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRLFIDGDGSPVKEDVIKLGESYGLDVVIVTSVDHYTTKEYANHVQIVYVDRGADSADYKIVGMVKKNDFLITQDYGLASLVLPKGVRVFHHSGKEFDEANIGTLLEQRYHSGKLRKAGIRTKGPKPFTEKDHMSFRQALKKAID 3KTS Chain:G ((45-113)) --------------ALVKYAQAGGKKVLLHADLVNGLKN-------------DDYAIDFL-CT-EICPDGIISTRGNAIMKAKQHKMLAIQ-RLFMIDS----------------------------------------------

General information: TITO was launched using: RESULT: Template: 3KTS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 241 -25487 -105.75 -369.37 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain G : 0.59 3D Compatibility (PKB) : -105.75 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.198

(partial model without unconserved sides chains): PDB file : Tito_3KTS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KTS-query.scw PDB file : Tito_Scwrl_3KTS.pdb: