Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKVEEGQREKLKTEMERLHTYITQLSQTFYDPDKEKVMVNYPNNSEGRQLEQVYHEVFKHLLTVKKELDYYSLPIIDTGILKYDGKKERFIFKSVR-EDL-PLSAGMDLEVLVEDYFTEEKHWVRTKLDYLPQAAGGTQASGWYITEDKELELEGVMARIRKKN 3NRL Chain:B ((5-73)) ----------------------------------------------------------------------------REGTLFYDTETGRYDIRFDLESFYGGLHCGECFDVKVK------DVWVPVRIEM---------GDDWYLVGLNVSRLDGLRVRM----

General information: TITO was launched using: RESULT: Template: 3NRL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 252 -17063 -67.71 -254.66 target 2D structure prediction score : 0.27 Monomeric hydrophicity matching model chain B : 0.63 3D Compatibility (PKB) : -67.71 2D Compatibility (Sec. Struct. Predict.) : 0.27 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.394

(partial model without unconserved sides chains): PDB file : Tito_3NRL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3NRL-query.scw PDB file : Tito_Scwrl_3NRL.pdb: