Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDIKLKDFEGPLDLLLHLVSKYQMDIYDVPITEVIEQYLAYVSTLQAMRLEVTGEYMVMASQLMLIKSRKLLPKVAEVTDLGDDLEQDLLSQIEEYRKFKLLGEHLEAKHQERAQYYSKAPTELIYEDAELVHDKTTIDLFLAFSNILAKKKEEFAQNHTTILRDEYKIEDMMIIVKESLIG----RDQLRLQDLFK---EAQNVQEVITLFLATLELIKTQELILVQEESFGDIYLMEKKEESQVPQS 1W1W Chain:F ((40-115)) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------KAIVQMAKILRKELSEEKEVIFTDVLKSQA----KREASRGFFDILSLATEGCIGLSQTEAFGNIKIDAKPA-------

General information: TITO was launched using: RESULT: Template: 1W1W.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 143 8785 61.43 144.02 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain F : 0.57 3D Compatibility (PKB) : 61.43 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.569

(partial model without unconserved sides chains): PDB file : Tito_1W1W.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1W1W-query.scw PDB file : Tito_Scwrl_1W1W.pdb: