Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSQASPVYQGSCLCQGIRYEIKGDIGDIIQCHCQRCRKSNGTAFATNAPINSADFKITQGEDLIKKFAVNGVYRWFCSECGSPLISSRDAQPELYRLRIGTLDTPLDQKPTMHIFAASKAEWECIHDDLPQYDERP 5FMF Chain:I ((4-17)) -------------------------------------------------------------------------FRFCRDCNNMLYPR-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5FMF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 13 -4337 -333.62 -309.79 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain I : 0.57 3D Compatibility (PKB) : -333.62 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.890

(partial model without unconserved sides chains): PDB file : Tito_5FMF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FMF-query.scw PDB file : Tito_Scwrl_5FMF.pdb: