Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFEFVMSEQPISPTVQLNTRGLRCPEPVMMLHQAIRKAKS--GDVVEVLATDP--STSWDIPKFCMHLGHELLLKEEVLDEQNHKEYRYLVQKG 2ZQE Chain:A ((3-60)) -------------VKEVDLRGLTVAEALLEVDQALEEARALGLSTLRLLHGKGTGALRQAIREALRRDKRV-----------------------

General information: TITO was launched using: RESULT: Template: 2ZQE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 157 -13643 -86.90 -252.65 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -86.90 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.681

(partial model without unconserved sides chains): PDB file : Tito_2ZQE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2ZQE-query.scw PDB file : Tito_Scwrl_2ZQE.pdb: