Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceSLLSTISN----DKCFVSSYKFTPDGRKVIEAS-QAAPGDGPI--TFTSTR-DNF-----HMTIQIDANCAPRNPDDIQKELPSHRGFDFYTKAHNLPGLNPRHN------------
5HS5 Chain:A ((2-117))TLLGFYKQYKALSEYIDKKYKLSLNDLAVLDLTMKHCKDEKVLMQSFLKTAMDELDLSRTKLLVSIRRLIEKERLSKVRSS-KDERKIYIYLNNDDISKFNALFEDVEQFLNILEHH


General information:
TITO was launched using:
RESULT:

Template: 5HS5.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 262 7392 28.21 81.23
target 2D structure prediction score : 0.41
Monomeric hydrophicity matching model chain A : 0.69

3D Compatibility (PKB) : 28.21
2D Compatibility (Sec. Struct. Predict.) : 0.41
1D Compatibility (Hydrophobicity) : 0.69
QMean score : 0.128

(partial model without unconserved sides chains):
PDB file : Tito_5HS5.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5HS5-query.scw
PDB file : Tito_Scwrl_5HS5.pdb: