Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFVEDINRVQAEDLLYGKPDGAFLIRES-SKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHY 1R1S Chain:C ((11-85)) WFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEK-FPSLNKLVDYY

General information: TITO was launched using: RESULT: Template: 1R1S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 264 -29953 -113.46 -404.77 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain C : 0.75 3D Compatibility (PKB) : -113.46 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.771

(partial model without unconserved sides chains): PDB file : Tito_1R1S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1R1S-query.scw PDB file : Tito_Scwrl_1R1S.pdb: