Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEKEIFDRIVTIIQERQG-EDFVVTESLSLKDDLDADSVDLMEFILTLEDEFSIEISDEEIDQLQNVGDVVKIIQGK 4IHH Chain:K ((6-78)) -----IEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGH

General information: TITO was launched using: RESULT: Template: 4IHH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 253 9204 36.38 127.83 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain K : 0.80 3D Compatibility (PKB) : 36.38 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.529

(partial model without unconserved sides chains): PDB file : Tito_4IHH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4IHH-query.scw PDB file : Tito_Scwrl_4IHH.pdb: