Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLKFTEDAWADYCYWQNQDKKTLKRINKLIKDIQRDPFTG-IGKPEPLKYDYQGAWSRRIDAENRLIYMMDGDSVAFLSFKDHY 3BPQ Chain:B ((3-80)) --VLFAKTFVKDLKHVPGH---IRKRIKLIIEECQNSNSLNLKLDIKKIKGY-HNYYRIRVG-NYSIGIEVNGDTIIFRRVLHR-

General information: TITO was launched using: RESULT: Template: 3BPQ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 280 -18414 -65.76 -242.28 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain B : 0.66 3D Compatibility (PKB) : -65.76 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.524

(partial model without unconserved sides chains): PDB file : Tito_3BPQ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3BPQ-query.scw PDB file : Tito_Scwrl_3BPQ.pdb: