Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGLRWTDTIDIAIELSEAHPEVDPQWIRFTDLHAWVCALP-DFSDDPNKLTEGLLEAIQMAWLDEVR 2KPM Chain:A ((38-78)) ---GWANLGNFGNYLNKLQPDFDSRLYGYKKLSDLVKARTDLFV-----------------------

General information: TITO was launched using: RESULT: Template: 2KPM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 76 -12497 -164.43 -312.41 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -164.43 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.537

(partial model without unconserved sides chains): PDB file : Tito_2KPM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2KPM-query.scw PDB file : Tito_Scwrl_2KPM.pdb: