Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMGITPMYVCLCRG-------------ITDQDIKDAIENGAESYRE-IRDLLDLGTCCGRCAPEARAII-SEELAE---IAARISVAA
4P78 Chain:A ((1-86))-MIYPIFIFKTVEGFDGYFPDIDGCFFAGNTFADISKNAEEAFAVHIEALMNEGFPLPSPPKDPHRYIDDPRLKEEGGILGFVEIDP


General information:
TITO was launched using:
RESULT:

Template: 4P78.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 666 3.23 9.79
target 2D structure prediction score : 0.37
Monomeric hydrophicity matching model chain A : 0.70

3D Compatibility (PKB) : 3.23
2D Compatibility (Sec. Struct. Predict.) : 0.37
1D Compatibility (Hydrophobicity) : 0.70
QMean score : 0.464

(partial model without unconserved sides chains):
PDB file : Tito_4P78.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4P78-query.scw
PDB file : Tito_Scwrl_4P78.pdb: