Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---MTDLNKKREVNLSFE-----QDDGA---VWVFDGDSHQGTEISHLMMMHSDEYNEDELRVICNHAAF------------EIDRLRAEL------EKSKAQAVPEAQQKLTDTYFWEGSDYVVDCP------FEYDIELDKGEVLELQKWQRTESTKVYFANIYKDEDNFEIL-QFASKA-------EAENAVAENLKFLEASESGAEG
3J6N Chain:K ((25-233))PEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVD-QVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPS-


General information:
TITO was launched using:
RESULT:

Template: 3J6N.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 649 62784 96.74 378.21
target 2D structure prediction score : 0.42
Monomeric hydrophicity matching model chain K : 0.66

3D Compatibility (PKB) : 96.74
2D Compatibility (Sec. Struct. Predict.) : 0.42
1D Compatibility (Hydrophobicity) : 0.66
QMean score : 0.234

(partial model without unconserved sides chains):
PDB file : Tito_3J6N.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3J6N-query.scw
PDB file : Tito_Scwrl_3J6N.pdb: