Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDLKTFTAQIELMHQEALRQSVSYEDKWLNTFHGGRESALDQVLKLLKGECRDG 3VEJ Chain:A ((2-41)) VDLTVPWDDIEALLKNN--------------FENDQAAVRQVMERLQKGWSLAK

General information: TITO was launched using: RESULT: Template: 3VEJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 60 -5217 -86.94 -130.41 target 2D structure prediction score : 0.85 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -86.94 2D Compatibility (Sec. Struct. Predict.) : 0.85 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.426

(partial model without unconserved sides chains): PDB file : Tito_3VEJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VEJ-query.scw PDB file : Tito_Scwrl_3VEJ.pdb: